all creators

Merve 🌸🫧

@temizlikrehberim · cleaning, asmr, satisfying

open on instagram

📍İSTANBUL Evimde kirlenen yerleri temizliyorum 🌸 🧺🛁🫧

https://www.youtube.com/@temizlikrehberim

63K followers
79 reels read
4082x best outlier
36.1x typical
237M views in here
21 Aug 2026 newest

how they make thembroad appeal, right length, show not tell, fast pacing, no text, shown not told, broad topic, crisp audio

mervedeep cleantemizlikrehberimcleaningsatisfying cleaningasmrcleaning asmrasmr cleaningscrubbingcleaning hackssatisfyingoutdoor cleaningcleaning routinewindow cleaninghome caresoap foamhouse chorescleaning motivationclean homehome organizationoddlysatisfyinghouse cleaningsoap bubbleswater rinse

79 reels in the database, most viral first

21

@temizlikrehberim Merve 🌸🫧 · 30 Jun 2026

156x outlier

A person cleans tile floors using a red spin mop and lots of white soap foam.

2.2M views
15K likes
39 comments
798 shares
0 saves
63K followers
15s long
0.7% liked
hookThe video opens with a sudden burst of rich soap foam being wrung from a red mop.
  • Visual setup. Thick white bubbles overflow from a red bucket on a tiled floor.
  • Audio vibe. Wet squishing sounds immediately grab your attention.
  • Broad interest. Watching soapy cleaning appeals to anyone who likes ASMR and neat rooms.
retainQuick scene changes and bubbly textures keep viewers tuned in until the floor is clean.
  • Fast pacing. The video has 9 shots in 14.9 seconds, switching every 1.7 seconds.
  • Show not tell. No voiceover is needed because the bubbly actions speak for themselves.
  • Key props. The bright red spin mop and green soap bottle make the video visual.
  • Easy steps. You watch soap poured, water mixed, and tiles scrubbed clean.
rewardViewers walk away feeling calm and inspired to tidy up their own floors.
  • Oddly satisfying. Squeezing thick white foam onto smooth tiles feels good to watch.
  • Soothing audio. Wet mop sounds create a relaxing rhythm.
  • Clean motivation. Seeing dirty tiles get shiny makes cleaning look quick and simple.
mervetemizlikrehberimcleaning asmrfoam partyspin mopsoapy floorsatisfying cleaningtile cleaningfloor washingoddly satisfyingsoap bubblescleaning routinedeep clean

Foam party ✨🪩🎧 . . . . #satisfying #oddlysatisfyingvideo #asmrcleaning #temizlik #reklamdeğildir

watch on instagram
22

@temizlikrehberim Merve 🌸🫧 · 10 Aug 2026

128x outlier

A person cleans gray tile floors using lots of fluffy soap foam and a squeegee.

1.8M views
21K likes
108 comments
1.6K shares
705 saves
63K followers
18s long
1.2% liked
hookThick white soap bubbles spinning under a mop grab attention right away.
  • Visual start. Thick white soap foam swirls over gray floor tiles under a spinning red mop.
  • Bright light. Clear lighting makes the thick bubbles look extra shiny and soft.
  • Simple sound. Original splashy water sounds play without any talking or music.
  • Broad appeal. Watching tile floors get cleaned is something almost anyone enjoys.
retainViewers stay to watch all the soapy bubbles scraped clean by the floor squeegee.
  • Satisfying action. The cleaning steps are shown visually instead of being explained.
  • Fast cuts. There are 9 shots in 18.3 seconds, changing about every 2.0 seconds to keep interest high.
  • Key tools. The mop, soapy bucket, and squeegee are central because the video does not work without them.
  • Easy story. The video goes from spinning the soapy mop to scrubbing tiles and scraping foam away.
  • Good length. The brief time fits the simple clean up idea without feeling slow.
rewardViewers feel relaxed and satisfied after watching a floor become spotless.
  • Deeply satisfying. Watching a squeegee push away thick foam leaves a smooth clean surface.
  • Cleaning spirit. Seeing rich soap bubbles makes people want to clean their own home.
  • Soothing mood. Natural soapy water sounds create a calm break from fast content.
mervecleaningoddlysatisfyingasmrtile floormoppingsoapy waterfoam cleaningsqueegeedeep cleanhome organizationsatisfactionclean lookfloor cleaningroutinehouse

No no no no noldu böyleee aaaaaa yazasım geldi buraya 😂

watch on instagram
23

@temizlikrehberim Merve 🌸🫧 · 4 Jun 2026

127x outlier

A person scrubs a white door with soapy foam and wipes it clean with a green cloth.

1.8M views
5.9K likes
39 comments
835 shares
1K saves
63K followers
14s long
0.3% liked
hookThe satisfying sound of soapy bubbles and a bright pink brush stops viewers right away.
  • Visual appeal. Thick white foam fills a bucket as a hand dips a bright pink brush into the water.
  • Crisp audio. Wet splashing and crunchy scrubbing sounds catch the ear right away.
  • No text. There are no words on screen, keeping all focus on the visual action.
  • Broad topic. Cleaning doors is a simple chore that almost anyone can relate to.
retainFast cuts and crunchy scrubbing sounds keep viewers watching until the door is clean.
  • Shown action. The video shows the entire cleaning process step by step without talking.
  • Fast pacing. There are 13 shots in 13.7 seconds, with a new shot about every 1.1 seconds.
  • Satisfying sounds. Real scrubbing and wiping sounds give a pleasant ASMR experience.
  • Key tools. A pink brush, bucket, and green cloth keep the quick routine simple.
  • Clear story. The actions move logically from lathering foam to wiping the surface clean.
  • Right length. The short 13.7 second time fits the small cleaning task perfectly.
rewardViewers feel a sense of calm and inspiration to clean their own home.
  • Deeply satisfying. Seeing bubbly soap scrubbed over dirty surfaces gives a feeling of order.
  • Calming ASMR. The wet scrubbing sounds provide a relaxing listening experience.
  • Quick motivation. It makes cleaning a front door look easy, quick, and fun to do.
mervecleaningasmrdoor cleaningdeep cleanscrubbingsatisfyinghome carecleaning routinesoap sudsmicrofiber clothpink brushhouse cleaning tipshousehold cleaning
24

@temizlikrehberim Merve 🌸🫧 · 25 Apr 2026

104x outlier

A woman scrubs soapy foam across tile floors to clean her balcony with satisfying sound effects.

1.5M views
10K likes
100 comments
1.5K shares
1.2K saves
63K followers
14s long
0.7% liked
hookThe loud splashing sound of a mop soaking in rich foam stops people from scrolling right away.
  • Satisfying sound. The video starts with the loud splash of a wet mop inside a bucket of soap.
  • Rich foam. Thick white bubbles overflow from the bucket onto a grey tiled floor.
  • No text. The screen stays clean with no text so you focus on the visuals and sounds.
  • Broad appeal. Soap bubbles and cleaning videos attract anyone who enjoys ASMR.
retainFast camera edits and thick white soap foam make watching the cleaning process deeply relaxing.
  • Show not tell. The video shows full cleaning action with natural water sounds instead of talking.
  • Fast video pace. There are 8 shots in 13.5 seconds, changing views every few seconds to stay fresh.
  • Simple tools. The red spin mop and floor squeegee push the white soap across the room.
  • Easy steps. You watch the mop splash, swirl soap over tiles, and scrape the foam away.
  • Short time. The video lasts under fourteen seconds, keeping the story quick and light.
rewardViewers feel a sense of calm and satisfaction from watching a floor get covered in fresh foam.
  • Very satisfying. Seeing thick white soap spread across dark grey tiles feels nice to watch.
  • Calm feelings. The wet crunching sound of the mop and squeegee scrapers calms your mind.
  • Clean inspiration. Watching the soapy floor makes you want to clean your own home.
mervetemizlikrehberimcleaning asmrfoam cleaningfloor scrubbingspin mopsatisfying foambalcony cleaningfloor squeegeeclean with mesoap bubbleshome cleaning tips

Köpük partisine davetlisiniz 🫧🪣🧘‍♀️ . . #cleaning #foamcleanser #scrub #cleanwithme #cleans

watch on instagram
25

@temizlikrehberim Merve 🌸🫧 · 15 Jun 2026

84.8x outlier

A satisfying video shows how to deep clean a dirty wooden window track with soap foam and a cloth.

1.2M views
9K likes
29 comments
232 shares
367 saves
63K followers
11s long
0.8% liked
hookThe loud squishy sound of soap foam being squeezed grabs attention right away.
  • First image. A hand squeezes rich white foam out of a bright green sponge.
  • The sound. Loud and crisp squishy soap sounds fill the audio.
  • The setting. A bright indoor space with a bucket of soapy water.
  • Broad appeal. Satisfying cleaning clips appeal to anyone who enjoys neat spaces.
retainFast edits showing dirt vanish into sparkling wood keep viewers watching until the end.
  • Shown not told. The quick cleaning action happens directly on screen without talking.
  • Pacing and edits. The video uses 8 shots in 10.5 seconds with quick cuts.
  • Clear transformation. Filthy window tracks become shiny and clean within seconds.
  • Easy story. The steps move smoothly from lathering foam to wiping and polishing.
  • Right length. The short duration fits the simple visual idea perfectly.
rewardViewers feel calm, satisfied, and inspired to tidy their own window tracks.
  • Deeply satisfying. Watching built up dirt get wiped away feels good.
  • Soothing audio. The squishy foam and rubbing sound effects relax the mind.
  • Home inspiration. Viewers want to grab a sponge and clean dirty corners.
mervecleaningasmrsatisfyingdeep cleanwindow cleaningwindow trackcleaning hackssoap foamhome cleaninghouse choressatisfying videosclean lookcleaning motivation

Yıkamacı yağlamacı 🤩

watch on instagram
26

@temizlikrehberim Merve 🌸🫧 · 23 May 2026

78.3x outlier

A clean home video shows vacuuming dust with a green light vacuum and mopping the floor under a bed.

1.1M views
11K likes
102 comments
2.3K shares
0 saves
63K followers
12s long
1.0% liked
hookThe glowing green light showing bright dust under a dark bed makes people stop scrolling.
  • Bright green light. A vacuum head lights up glowing green dust on a wooden floor.
  • Close setting. The camera stays right on the floor near the bed.
  • Vacuum sounds. Real suction noises play clearly without background music.
  • Onscreen text. Turkish text talks about relaxing while watching.
  • Broad topic. Cleaning and satisfying dust removal appeal to almost anyone.
retainQuick scene changes and clear dirt removal keep viewers watching until the floor is clean.
  • Show not tell. The video shows dirt disappearing instead of explaining how to clean.
  • Fast pacing. There are 6 shots in 11.9 seconds, with a new shot about every 2.0 seconds.
  • Cool tools. The illuminated vacuum and spinning mop show obvious results.
  • Easy steps. First the vacuum sucks up dust, then the mop cleans the floor.
  • Right length. At under twelve seconds, the clip finishes right when the floor is shiny.
rewardViewers feel calm and satisfied after watching a dirty floor become spotless.
  • Deep satisfaction. Seeing mess disappear instantly feels very rewarding.
  • Calm feeling. The simple cleaning steps give a gentle mental break.
  • Cleaning motivation. Watching the neat floor makes people want to tidy their own space.
mervecleaning videolaser vacuumdyson vacuummoppingsatisfying cleaninghouse cleaningdeep cleanunder bed cleaningasmr cleaningclean homefloor cleaninghome care

Siz yatak altını ne kadar sürede bir temizliyorsunuz 🪄⭐️

watch on instagram
27

@temizlikrehberim Merve 🌸🫧 · 5 Jul 2026

75.3x outlier

A hand scrubs dirty concrete on a balcony ledge with a brush and soapy water before rinsing it clean.

1.1M views
8.6K likes
20 comments
306 shares
0 saves
63K followers
15s long
0.8% liked
hookThe loud sound of a brush scrubbing dark grime off concrete makes people stop to watch.
  • First view. A close shot shows a hand holding a small white brush against a dark dirty ledge.
  • The scene. Bright daylight shines on dusty stone high above a city street.
  • The audio. Loud wet scrubbing sounds create immediate ASMR appeal.
  • No text. No text on screen keeps all the attention on the dirty surface.
  • Wide appeal. Deep cleaning videos attract anyone who enjoys neat and tidy spaces.
retainThe quick shift from thick foam to a clean water rinse keeps people watching until the end.
  • Show not tell. The video shows dirt lifting away without any talking or voiceover.
  • Unbroken shot. One unbroken take lasts 14.5 seconds with a smooth, continuous camera view.
  • Simple props. A simple brush and soapy water make the cleaning process look easy.
  • Clear steps. The hand scrubs foam across the dirt and pours water to wash it away.
  • Perfect length. The brief runtime matches the quick task without dragging.
rewardViewers feel a pleasing sense of order as a dirty outdoor ledge becomes spotless.
  • Soothing feeling. The natural scrubbing sounds offer a calm and relaxing experience.
  • Visual satisfaction. Watching thick brown dirt wash off to reveal clean stone feels great.
  • Cleaning idea. It reminds viewers how simple tools can fix dirty areas around the home.
mervecleaningasmrsatisfyingdeep cleanbalcony cleaningscrubbingwater rinsescrubbing brushoutdoor cleaninggrime removaldirt cleaningrelaxing soundsvisual satisfaction

PART 7 ⭐️ . . . #Satisfying #odlysatisfyingcleaning #asmrcleaning #cleaningasmr #temizlik

watch on instagram
28

@temizlikrehberim Merve 🌸🫧 · 17 Jul 2026

73.8x outlier

A person cleans a dirty outdoor marble ledge using green soap, a hand brush, and fresh water.

1M views
6K likes
12 comments
241 shares
337 saves
63K followers
13s long
0.6% liked
hookThe satisfying squirt of bright green soap onto a dirty white marble surface grabs attention right away.
  • Bright visual start. Bright green soap squirts onto dirty white marble in the first frame.
  • Outdoor setting. Daylight shines on a marble balcony ledge with green trees behind it.
  • Natural sound effects. Crisp soap squirts and scrubbing sounds play without any music.
  • Broad audience appeal. Anyone who likes satisfying cleaning videos will stop to watch.
retainThe steady scrubbing action builds curiosity to see how clean the stone will get.
  • Satisfying action. Scrubbing turns dark dirt into thick white foam on the marble surface.
  • Show not tell. The creator shows the whole cleaning process without speaking a word.
  • Pacing and cuts. Three shots in 12.9 seconds with cuts at 6.1s and 10.5s keep the video moving.
  • Key props. Green soap, a gray scrubbing brush, and a water hose make the video work.
  • Simple story structure. The clear three-step process is easy for anyone to follow.
  • Perfect length. The short duration fits the quick cleaning demonstration.
rewardViewers feel a sense of satisfaction seeing dirty stone become bright and clean.
  • Deeply satisfying outcome. Watching dirty foam rinse away to reveal shiny marble feels great.
  • Sense of calm. The rhythmic scrubbing and water rinsing sounds are relaxing to hear.
  • Inspiration to clean. The simple process makes outdoor cleaning look fun and easy.
mervetemizlikrehberimcleaningasmrsatisfying cleanoutdoor cleaningscrubbingmarble cleaningsoapyrinsing waterdeep cleanbalcony cleaningsatisfying videoquick cleaning

💚🫧🧹

watch on instagram
29

@temizlikrehberim Merve 🌸🫧 · 6 Jun 2026

73.5x outlier

A person scrubs a dirty glass table with soap and a pink brush, then wipes it clean with a squeegee.

1M views
6.5K likes
22 comments
128 shares
0 saves
63K followers
13s long
0.6% liked
hookThe bright blue soap pouring onto a pink brush on glass catches your eye right away.
  • First visual. Bright blue cleaning gel pours onto a pink brush lying on a dirty glass surface.
  • Light and setting. Bright daylight reflects off the textured outdoor glass table.
  • Audio sounds. The crisp sound of liquid pouring and scrubbing fills the original audio.
  • Broad appeal. Satisfying cleaning videos appeal to almost everyone who likes neat spaces.
retainViewers watch until the end to see all the foamy soap scraped away to reveal clear glass.
  • Shown not told. The video shows the cleaning steps directly without any talking.
  • Fast pacing. There are 8 shots in 13.4 seconds, changing angle with every squeegee stroke.
  • Satisfying result. The squeegee glides over bubbly foam to leave a spotless streak-free shine.
  • Simple process. The story is simple to follow from dirty table to clean finish.
rewardThe viewer feels relaxed and wants to clean their own home after watching.
  • Deeply satisfying. Seeing thick foam wiped away in smooth lines feels very nice.
  • Calming sounds. The crunch of the brush bristles and squeegee scrapes feel peaceful.
  • Good inspiration. It makes you want to grab a squeegee and clean your own glass tables.
mervetemizlikrehberimcleaning videosatisfying asmrglass table cleaningsqueegee wipesoap bubblespink brushvisual satisfactionneat homecleaning motivationclear glass

⭐️💦🩷

watch on instagram
30

@temizlikrehberim Merve 🌸🫧 · 22 May 2026

71.8x outlier

A person uses a spinning mop and bucket to clean water off a wooden floor.

1M views
11K likes
143 comments
3.6K shares
0 saves
63K followers
16s long
1.1% liked
hookThe video stops viewers with crisp cleaning sounds and a spill being wiped off a sunlit floor.
  • First visual. Water spills across a light wooden floor.
  • Setting and light. Bright daylight shines through the room onto the shiny floor.
  • Crisp audio. Clear water splashes and scrubbing sounds play without music.
  • Text prompt. A Turkish caption asks cleaning fans to watch until the end.
  • Broad appeal. Anyone who enjoys neat spaces or satisfying sounds will stop to watch.
retainQuick cuts and neat cleaning action keep viewers watching until the floor shines.
  • Useful demo. It shows how the spinning mop bucket squeezes out dirty water quickly.
  • Show not tell. The video shows the floor being wiped clean instead of talking about it.
  • Fast pacing. There are 12 shots in 16.1 seconds, changing every 1.3 seconds.
  • Key props. The mop and spinning bucket are essential to show the cleaning steps.
  • Clear story. The video follows a simple path from wet floor to dry clean floor.
  • Right length. The 16.1 seconds runtime is just enough to show the full floor wipe.
rewardViewers feel calm and satisfied after watching the floor become clean and shiny.
  • Very satisfying. Watching water stains disappear under the mop feels rewarding.
  • Calming sounds. The wet scrubbing audio creates a pleasant relaxing moment.
  • Good motivation. The tidy room makes people want to clean their own floors.
mervetemizlikrehberimcleaning asmrmop bucketfloor cleaningsatisfying cleaninghome cleaningcleaning routinewood floor mopturkish cleaning videohome organizationclean home

🫧 Temizlik yapması ayrı, ortaya çıkan görüntüyü izlemek ayrı keyif. Sizce de öyle değil mi? ✨ ✨ Temizlik takıntısı olanlar burada mı? 🫧🤍 . . . #temizlik #temizlikvideolari #evtemizligi #mop #cleaningasmr

watch on instagram
31

@temizlikrehberim Merve 🌸🫧 · 19 Jul 2026

66.4x outlier

This video shows quick clips of cleaning with rich soap foam and satisfying sounds.

930K views
15K likes
42 comments
905 shares
0 saves
63K followers
13s long
1.6% liked
hookA viewer stops scrolling because of the close-up view of soft pink foam squeezing through a hand.
  • Hand and foam. Thick pink soap foam squeezes out in a tight close up shot.
  • Bright clean spot. The background is bright and neat like a fresh bathroom or kitchen.
  • Squishy sound. Crisp water splashing and suds bubbling make crisp satisfying noise.
  • Text on screen. Soft text says turn up the sound with a headphone picture.
  • Broad appeal. Everyone likes clean spaces and soft satisfying textures.
retainViewers keep watching to hear and see every fast splash, scrub, and soap squeeze.
  • Fast changes. The video cuts 12 times across 13 shots in 13.0 seconds, changing almost every second.
  • Satisfying actions. Each short clip shows scrubbing, wiping, or pouring soapy liquid.
  • No talking. The audio uses only real cleaning sounds like splashing water and squeaky sponges.
  • Soapy props. Foam buckets, mop pads, and squeegees keep the visual energy high throughout.
  • Easy structure. Each scene shows a quick satisfying action without any confusing plot.
  • Perfect length. At just 13 seconds, the quick video ends before the feeling fades.
rewardViewers feel calm, refreshed, and motivated to clean their own home.
  • Calm feeling. The soft sounds of foam and water soothe the mind.
  • Clean feeling. Bright soapy surfaces make everything look fresh and clean.
  • Cleaning idea. Watching quick scrubbing makes chores look fun and easy.
mervetemizlikrehberimcleaning asmrsatisfying soundsoap sudsfoam cleaningscrub spongesqueegee glassmop floorclean homebubble soapcleaning hackslook cleaningsoft foam

Sese doğru gel 🩷🎧⭐️

watch on instagram
32

@temizlikrehberim Merve 🌸🫧 · 24 May 2026

65.8x outlier

A person pours soap and water on a mop to scrub a tiled floor until it is covered in foamy bubbles, then vacuums it all clean.

921K views
14K likes
74 comments
1.3K shares
1.3K saves
63K followers
17s long
1.6% liked
hookBright light and rich bubbly textures immediately capture the viewer's eye.
  • Visual setup. Bright light shines on a tiled floor as colorful soap pours down.
  • Audio pull. Squishy foam sounds play softly without any background music.
  • Clear action. Liquid soap streams onto a mop head right before water washes over it.
  • Broad appeal. Satisfying cleaning clips appeal to anyone who likes neat and shiny rooms.
retainThe steady progress from messy bubbles to a spotless shiny floor keeps viewers watching until the end.
  • Visual payoff. Thick white foam spreads across the tiles in satisfying swirling shapes.
  • Show not tell. The video explains every step through rich sounds and clear actions instead of speaking.
  • Steady cuts. 7 shots in 16.8 seconds keep the action moving at a lively pace.
  • Key tools. The mop and wet vacuum are essential to turn the messy foam into a clean surface.
  • Easy steps. The story moves smoothly from soaping the mop to scrubbing and vacuuming.
  • Right length. The clip finishes right as the last drop of water disappears from the floor.
rewardViewers feel relaxed and inspired by the smooth transformation of a bubbly floor.
  • Visual satisfaction. Watching thick foam get sucked away by the vacuum feels deeply satisfying.
  • Sound delight. Squishy soap bubbles and splashy water create a relaxing audio experience.
  • Fresh motivation. Seeing the bright tiled floor encourages people to tackle their own chores.
mervetemizlikrehberimcleaning videosatisfying foammopping floorfloor cleaningwet vacuumfoam scrubbingsoap bubblesasmr cleaningtidy homefloor washingsoap satisfaction

⭐️🌸🫧

watch on instagram
33

@temizlikrehberim Merve 🌸🫧 · 2 Aug 2026

63.5x outlier

A person sweeps, scrubs, and rinses a dirty outdoor patio covered in leaves and fallen apples.

889K views
6.7K likes
13 comments
166 shares
0 saves
63K followers
15s long
0.8% liked
hookA viewer stops scrolling to watch dirty floor tiles get swept clean with crisp, satisfying audio.
  • Clear view. A person sweeps a dirty tiled balcony with a broom.
  • Crisp audio. The sound of sweeping leaves immediately grabs your ears.
  • Messy floor. Fallen apples and leaves create a big mess that needs fixing.
  • Broad subject. Cleaning videos appeal to almost anyone on social media.
retainPeople watch until the end to see the messy patio transform into a shiny clean space.
  • Show not tell. The video shows the entire cleaning job without any talking.
  • Fast pace. The video has 8 shots in 15.1 seconds to keep things moving.
  • Simple steps. You see sweeping, soaping, scrubbing, and rinsing in clear order.
  • Key tools. The broom, soap, and water hose are needed to complete the job.
  • Short length. The whole job takes only 15 seconds to watch from start to end.
rewardViewers feel calm and satisfied after seeing a dirty space become tidy and clean.
  • Very satisfying. Watching the dirt wash away gives a happy feeling.
  • Soothing sounds. The real water and scrubbing sounds help you relax.
  • Clean urge. It inspires you to tidy up your own dirty outdoor spaces.
mervetemizlikrehberimcleaningasmrpatiobalconysweeping leavesscrubbing tilessatisfying cleanoutdoor cleaningdeep cleannatural soundscleaning motivationwater rinse

Elma ağacı vs ben 🍂🍃💅🏻

watch on instagram
34

@temizlikrehberim Merve 🌸🫧 · 28 May 2026

57.8x outlier

A fast video shows soapy foam and cleaning actions in satisfying close up shots.

810K views
6.6K likes
38 comments
376 shares
316 saves
63K followers
9s long
0.8% liked
hookA person stops scrolling to see thick soapy bubbles squishing and splashing in rich detail.
  • Visual start. White bubbly foam fills the screen in a close shot.
  • Bright light. Clear lighting makes every bubble shine brightly on screen.
  • Soothing audio. The real sound plays squishy bubble pops and water splashes.
  • No text. No words cover the video to distract from the visuals.
  • Broad appeal. Satisfying cleaning visuals appeal to almost anyone on social media.
retainViewers keep watching because every single second brings a new soapy texture or satisfying clip.
  • Fast cuts. The video has 9 shots in 9.1 seconds, changing every second to hold attention.
  • Showing visuals. Colorful sponges, mops, and carpet scrubbers show the soap without any talking.
  • Soapy props. Sponges, brushes, and mops make the soapy textures possible.
  • Simple flow. Each quick clip flows into the next without any complicated story.
  • Right length. At under ten seconds, the video ends while still feeling fun.
rewardThe viewer feels relaxed and refreshed after watching quick shots of soapy cleaning.
  • Deeply satisfying. Watching bubbles spread and pop helps calm the mind.
  • Clean feeling. Crisp sounds and bubbly water make the screen feel fresh.
  • Urge to clean. Viewers might feel inspired to scrub something or make foam.
mervecleaning asmrsoap bubblessatisfying visualscarpet cleaningmop foamsoap squeezeclean lookoddlysatisfyingrelaxing audiofoam asmrsoap montagefresh feelingscrub
35

@temizlikrehberim Merve 🌸🫧 · 30 Apr 2026

49.6x outlier

A person scrubs soapy foam onto a dirty window track and rinses it clean.

694K views
27K likes
78 comments
1.8K shares
1.3K saves
63K followers
14s long
3.8% liked
hookThe thick white bubbles and crunchy scrub sound make people stop instantly.
  • Soapy hands. A hand dips into a bucket filled with thick white foam.
  • Bright window. Natural light shines through blinds onto a window frame.
  • Crisp sounds. Soft soap bubbles and squishy foam create rich sound effects.
  • Floating emojis. Cute heart and car emojis stay in the middle of the frame.
  • Wide appeal. Deep cleaning videos attract anyone who enjoys neat home spaces.
retainThe rapid cuts and rich foam keep viewers watching to see the final rinse.
  • Pure satisfaction. Watching soapy foam wipe away dark grime feels very pleasing.
  • Show not tell. The camera shows every scrub without any talking or instructions.
  • Steady action. Soapy hands move smoothly across the narrow frame track.
  • Fast pacing. The clip uses 11 shots in 13.7 seconds, cutting every 1.2 seconds.
  • Simple tools. A pink bristle brush and soap bucket make the task clear.
  • Clear steps. The video moves from lathering soap to rinsing with water.
  • Short duration. Less than 14 seconds is the perfect length for a quick scrub.
rewardViewers feel a sense of calm and a sudden urge to clean their own windows.
  • Deep calm. The squishy soap sounds help lower stress and soothe the brain.
  • Pure satisfaction. Watching grey grime turn sparkling clean brings instant joy.
  • Good reminder. The clip reminds viewers to clean hidden window tracks at home.
mervetemizlikrehberimcleaningasmrsatisfying cleanwindow cleaningwindow sillscrubbingsoap foampink brushwindow trackdeep cleancleaning motivationcleaning therapy

Kız terapisi 🩷🫧✨ . . . #cleaningmotivaon #asmrcleaning #asmrtemizlik #satisfying #odlysatisfying

watch on instagram
36

@temizlikrehberim Merve 🌸🫧 · 18 Jul 2026

49.2x outlier

A person scrubs dirty bathroom floor tiles with purple spray cleaner and a small brush until they are spotless.

689K views
3.2K likes
31 comments
96 shares
150 saves
63K followers
16s long
0.5% liked
hookThe video stops scrolling viewers immediately with a close look at filthy tiles and realistic scrubbing sounds.
  • Dirty visual. A close camera view shows very dirty gray tiles with thick dark grime.
  • Bright room. Natural lighting clearly highlights the messy floor near a white cabinet.
  • Natural audio. Real spraying and scrubbing noises play without any background music.
  • Broad appeal. Anyone who enjoys cleaning clips or satisfying home tips will stay to watch.
retainViewers stay until the end to watch the thick floor grime get wiped away completely.
  • Quick cuts. The video has 13 shots in 16.0 seconds to keep the action moving fast.
  • Show not tell. Every step is shown on screen without speech or text on the video.
  • Satisfying progress. Watching soapy foam loosen stubborn dirt holds the viewer's attention.
  • Basic tools. A spray bottle and a small brush make the process simple to follow.
rewardViewers feel a sense of calm satisfaction and get motivated to clean their own floors.
  • Very satisfying. Watching dark grime disappear under clean foam feels quiet and pleasing.
  • Clean inspiration. The dramatic change inspires viewers to tackle messy spots at home.
  • Soothing sound. The steady sound of scrubbing creates a relaxing rhythm.
mervetemizlikrehberimcleaning motivationclean homeoddly satisfyingtile cleaninggrout scrubbathroom deep cleansatisfying scrubbingspray bottleasmr cleaningscrubbing floor

💜✨ . . . . #Cleaningmotivation #cleanhomemagic #odlysatisfying #temizlik #reklam

watch on instagram
37

@temizlikrehberim Merve 🌸🫧 · 8 Aug 2026

46.1x outlier

A person scrubs green moss off a dirty wall using a pink brush and rinses it clean with water.

646K views
4.5K likes
14 comments
87 shares
111 saves
63K followers
12s long
0.7% liked
hookPeople stop scrolling to watch dirty green moss get scrubbed off a wall.
  • Bright yellow bottle. A hand pours liquid cleaner onto a mossy wall.
  • Outdoor light. The video uses bright daylight on a dirty brick wall.
  • Natural audio. You hear real scrubbing sounds without any background music.
  • No text overlay. The screen stays clean without any text.
  • Broad appeal. Watching dirty surfaces get clean appeals to almost everyone.
retainViewers watch until the end to see the dirty wall get completely washed clean.
  • Showing the work. The video shows the cleaning process instead of explaining it.
  • Fast video cuts. The video uses 4 shots in 11.9 seconds to keep things moving.
  • Simple tools. A pink brush and water are the main tools used.
  • Clear sequence. The steps move smoothly from pouring cleaner to scrubbing to rinsing.
  • Good video length. The total time of 11.9 seconds matches the quick idea perfectly.
rewardViewers feel a sense of calm and satisfaction after watching the moss wash away.
  • Very satisfying. Watching green grime rinse off a white wall feels great.
  • Soothing sounds. The rough scrubbing and water splashes create pleasant ASMR sounds.
  • Motivated to clean. The clip makes viewers want to clean dirty spots at home.
mervetemizlikrehberimcleaningmoss removalasmr cleaningscrubbing wallsatisfying cleanmoss scrubbingoutdoor cleaningrinsing waterpink brushwall cleaningoddlysatisfying

🍃✨🌸 . . . . #satisfying #oddlysatisfying #cleaningmotivation #asmrcleaning #temizlik

watch on instagram
38

@temizlikrehberim Merve 🌸🫧 · 20 Jun 2026

45.8x outlier

A woman deep cleans dirty window frames and white plastic panels using pink soap and sponges with clear scrubbing sounds.

641K views
2.4K likes
26 comments
119 shares
184 saves
63K followers
13s long
0.4% liked
hookThe bright pink soap squeezing onto the white window frame creates an immediate visual and sound pull.
  • Bright action. Pink cleaning gel squirts along a white window frame right away.
  • Sunlit setting. Bright daylight shines through a balcony window onto the frame.
  • Crisp sound. Loud scrubbing and scraping noises play without any background music.
  • No text. No text on screen gets in the way of the clean visuals.
  • Broad appeal. Cleaning videos appeal to anyone who likes neat and tidy homes.
retainFast cuts and satisfying foam scrubbing keep viewers hooked through every step of the cleaning process.
  • Useful routine. The simple steps show how to remove dirt from tight window grooves.
  • Show not tell. Every step happens on screen without any talking or extra explanation.
  • Fast pacing. The video uses 14 shots in 12.9 seconds to keep the action moving.
  • Key props. Pink sponges, small brushes, and a water bucket make the work fun to watch.
  • Simple story. The clip follows a clear path from dirty frames to squeaky clean panels.
  • Right length. At under thirteen seconds, the quick montage ends while still satisfying.
rewardViewers get a calm feeling from watching dirty surfaces turn bright white and clean.
  • Oddly satisfying. Watching pink foam wipe away grime gives a quick feeling of relief.
  • Soothing sounds. The gentle scrubbing and water splashing sound pleasant and quiet.
  • Clean inspiration. The quick results make people want to tidy their own window frames.
mervetemizlikrehberimasmr cleaningwindow cleaningsatisfying scrubdeep cleanhouse cleaningbalcony cleancleaning hackssoap foamasmr soundcleaning routinetidy up

Çatı katından devam ✨🧼 . . . #asmrcleaning #satisfying #odlysatisfying #temizlik #cleanwithme

watch on instagram
39

@temizlikrehberim Merve 🌸🫧 · 25 Jun 2026

44.4x outlier

A woman demonstrates a clever window cleaning tool that washes and squeegees glass easily.

622K views
8.5K likes
108 comments
327 shares
515 saves
63K followers
15s long
1.4% liked
hookThe crisp visual and sound of bright blue cleaning liquid pouring into a bucket immediately grabs attention.
  • Bright visuals. Liquid streams into a bucket with crisp water sounds.
  • Simple setup. A clean bucket and blue detergent set a fresh tone.
  • Upbeat audio. Real soapy water sounds make the task feel satisfying.
  • Universal topic. Cleaning windows quickly appeals to anyone with a home.
retainFast cuts show the tool in action, making window cleaning look effortless and satisfying.
  • Clever tool. The squeegee mop combination solves an everyday chore problem.
  • Visual proof. Showing soap suds wiped away cleanly delivers instant satisfaction.
  • Fast pacing. 11 shots in 14.7 seconds keep the action moving every second.
  • Essential props. The green window cleaner mop is central to the video.
  • Clear progression. Dipping the tool, soaping glass, and squeegeeing clean is easy to follow.
rewardViewers feel satisfied watching glass get cleaned instantly and want to try the handy tool.
  • Visual satisfaction. Watching soapy foam vanish cleanly brings a sense of order.
  • Product desire. The tool makes chores look so easy that viewers want one.
  • Useful tip. Viewers learn a faster way to clean large outdoor glass doors.
mervecleaning hackswindow squeegeehome organizationsatisfying cleaningclean tokhouse choresglass cleaning toolwindow washercleaning lookfoam squeegeecleaning product

Bugün işimi kolaylaştıran küçük bir yardımcı vardı. 🫧 🎧🫧🪩

watch on instagram
40

@temizlikrehberim Merve 🌸🫧 · 1 Jul 2026

36.1x outlier

A person deep cleans dirty white window frames using bright pink foam soap and a small brush.

506K views
1.9K likes
26 comments
116 shares
138 saves
63K followers
12s long
0.4% liked
hookBright pink soap oozing down a dirty window frame immediately catches the viewer's eye.
  • Visual surprise. Thickets of bright pink foam drip down a dirty white window frame.
  • Setting and light. Sunlight streams through a large glass window in a cozy room.
  • Satisfying sounds. Crunching brush sound effects play without background music.
  • Broad audience appeal. Cleaning videos attract anyone who enjoys neat and tidy homes.
retainQuick cuts and visual satisfaction keep the viewer locked in until the final wipe.
  • Useful cleaning trick. The video shows how a narrow brush reaches tight corners easily.
  • Shown not told. The creator demonstrates every step clearly without saying a word.
  • Fast editing. The video features 10 shots in 11.8 seconds with cuts every 1.2 seconds.
  • Essential tools. The small brush and pink cleanser drive the whole demonstration forward.
  • Easy structure. The video moves cleanly from spraying to scrubbing, rinsing, and wiping.
rewardViewers feel a sense of calm satisfaction and get inspired to clean their own home.
  • Visually satisfying. Watching grimy corners turn pure white feels wonderfully relaxing.
  • Practical learning. Viewers gain a simple technique for cleaning tricky window gaps.
  • Motivation to clean. The tidy final result makes people want to scrub their own windows.
mervetemizlikrehberimcleaning tipswindow cleaningsatisfying cleaningasmr cleaningpink soapwindow frame scrubhome hacktidy homedeep cleancleaning hackshouse chores