all creators

Merve 🌸🫧

@temizlikrehberim · cleaning, asmr, satisfying

open on instagram

📍İSTANBUL Evimde kirlenen yerleri temizliyorum 🌸 🧺🛁🫧

https://www.youtube.com/@temizlikrehberim

63K followers
80 reels read
4082x best outlier
40.3x typical
239M views in here
21 Aug 2026 newest

how they make thembroad appeal, right length, show not tell, fast pacing, no text, shown not told, broad topic, crisp audio

mervedeep cleantemizlikrehberimcleaningsatisfying cleaningasmrcleaning asmrasmr cleaningscrubbingcleaning hackssatisfyingoutdoor cleaninghome carecleaning routinecleaning motivationwindow cleaningsoap foamhouse choresclean homehome organizationoddlysatisfyinghouse cleaningsoap bubblesfoam cleaning

80 reels in the database, most viral first

41

@temizlikrehberim Merve 🌸🫧 · 1 Jul 2026

36.1x outlier

A person deep cleans dirty white window frames using bright pink foam soap and a small brush.

506K views
1.9K likes
26 comments
116 shares
138 saves
63K followers
12s long
0.4% liked
hookBright pink soap oozing down a dirty window frame immediately catches the viewer's eye.
  • Visual surprise. Thickets of bright pink foam drip down a dirty white window frame.
  • Setting and light. Sunlight streams through a large glass window in a cozy room.
  • Satisfying sounds. Crunching brush sound effects play without background music.
  • Broad audience appeal. Cleaning videos attract anyone who enjoys neat and tidy homes.
retainQuick cuts and visual satisfaction keep the viewer locked in until the final wipe.
  • Useful cleaning trick. The video shows how a narrow brush reaches tight corners easily.
  • Shown not told. The creator demonstrates every step clearly without saying a word.
  • Fast editing. The video features 10 shots in 11.8 seconds with cuts every 1.2 seconds.
  • Essential tools. The small brush and pink cleanser drive the whole demonstration forward.
  • Easy structure. The video moves cleanly from spraying to scrubbing, rinsing, and wiping.
rewardViewers feel a sense of calm satisfaction and get inspired to clean their own home.
  • Visually satisfying. Watching grimy corners turn pure white feels wonderfully relaxing.
  • Practical learning. Viewers gain a simple technique for cleaning tricky window gaps.
  • Motivation to clean. The tidy final result makes people want to scrub their own windows.
mervetemizlikrehberimcleaning tipswindow cleaningsatisfying cleaningasmr cleaningpink soapwindow frame scrubhome hacktidy homedeep cleancleaning hackshouse chores
42

@temizlikrehberim Merve 🌸🫧 · 10 Apr 2026

34.5x outlier

A woman takes apart her Dyson vacuum cleaner to wash every piece with soap and water in a crisp ASMR video.

483K views
3.3K likes
19 comments
924 shares
818 saves
63K followers
24s long
0.7% liked
hookA full vacuum bin snaps open right away with crisp sound, instantly pulling in fans of satisfying cleaning videos.
  • Dirty vacuum. A clear bin filled with gray dust and hair fills the screen.
  • Bright bathroom. Clean white light shines over a tidy bathroom sink.
  • Crisp audio. Real snapping and popping sounds fill the background without any music.
  • Broad topic. Vacuum cleaning appeals to anyone who likes neat homes and satisfying visual fixes.
retainQuick cuts and thick soap bubbles keep the viewer glued to see every dirty piece become spotless.
  • Fast cuts. The video uses 23 shots in 23.8 seconds to keep the action moving every second.
  • Visual satisfaction. Watching thick soap suds wash away gray grime feels soothing and fun to watch.
  • Clear progression. The story moves cleanly from emptying dirt to scrubbing filters and wiping rollers.
  • No talking. The simple visual demonstration needs no voiceover or text to be understood.
rewardViewers feel a sense of calm and learn the exact steps to scrub their own vacuum cleaner.
  • Deeply relaxing. The gentle scrubbing and water sounds help soothe a busy mind.
  • Clear instructions. Viewers learn how to safely detach and wash various filter parts.
  • Motivating energy. Watching the vacuum turn spotless makes people want to clean their own home tools.
mervetemizlikrehberimdyson cleaningvacuum cleaningasmr cleaningdeep cleaning routinesatisfying cleaningwashing vacuum filterhome cleaning tipsdyson maintenancecleaning videos

Detaylı dyson temizliği 🫧✨ . . . #evtemizliği #dysontemizliği #dysoncleaning #asmrcleaning #satisfying reklam değil

watch on instagram
43

@temizlikrehberim Merve 🌸🫧 · 23 Jul 2026

33.9x outlier

A person cleans dirty window tracks and glass using pink soap, a scraper, and a foam scrubber with satisfying audio.

474K views
3.3K likes
19 comments
74 shares
141 saves
63K followers
13s long
0.7% liked
hookA close view of dark dirt being scraped off a window frame grabs immediate attention with crisp sound.
  • Quick visual. A hand scrapes thick dirt off a white window track in a close shot.
  • Bright setting. Bright daylight fills the sunny window area.
  • Crisp sound. Real scraping sounds play with no background music or talking.
  • No text. No text overlays get in the way of the visual action.
  • Broad topic. Cleaning dirty window frames is a common chore everyone knows.
retainFast cuts and crisp cleaning sounds keep the viewer watching each step of the transformation.
  • Useful idea. Showing how to scrape deep grime and scrub glass gives helpful cleaning tips.
  • Quick cuts. The video has 10 shots in 12.8 seconds, with a new shot about every 1.3 seconds.
  • Satisfying progress. The window frame goes from brown grime to sparkling clean step by step.
  • Crucial tools. The scraper, pink soap, foam scrubber, and cloth make the cleaning process possible.
  • Satisfying audio. Clear sound effects of scraping, foaming water, and wiping keep the mood calm and focused.
rewardViewers feel satisfied by the deep clean and inspired to tidy their own windows.
  • Very satisfying. Watching thick dirt vanish gives a pleasant feeling of order.
  • Useful tip. Viewers learn how to use a small scraper for tight window tracks.
  • Soothing audio. Calm scraping and splashing sounds make the video relaxing to watch.
  • Spark of inspiration. The clean result makes people want to scrub their own home surfaces.
mervecleaningwindow cleaningasmrsatisfyingdeep cleanwindow track cleaninghome cleaning hacksscrubbingcleaning toolswindow glasscleaning routinesoapsqueegeeclean home
44

@temizlikrehberim Merve 🌸🫧 · 14 May 2026

32.8x outlier

A woman scrubs soapy foam across a wood floor to create a satisfying cleaning video.

460K views
2.9K likes
74 comments
196 shares
200 saves
63K followers
12s long
0.6% liked
hookPink liquid pouring onto a wood floor grabs attention because it looks like an accident.
  • Visual shock. Pink liquid spills straight onto a light wooden floor.
  • Bright lighting. Clean sunlight makes every drop of liquid pop on camera.
  • Crunchy sound. Rhythmic scrubbing noises start immediately with no background music.
  • Broad appeal. Cleaning mess and making soap bubbles appeals to almost everyone.
retainFast cuts and crisp scrubbing sounds keep viewers watching to see the floor wiped completely clean.
  • Visual payoff. Foamy bubbles swirl across the floor before getting scraped away.
  • Crisp sound effects. Loud scrubbing and squeegee scrapes sound very satisfying.
  • Fast pacing. Ten shots in 11.5 seconds keep the action moving every second.
  • Simple story. Spilling liquid, scrubbing foam, and wiping clean is easy to follow.
  • Short duration. The quick 11.5 second runtime fits the simple action perfectly.
rewardThe viewer feels relaxed and satisfied by watching a messy floor become spotless.
  • Deep satisfaction. Seeing thick foam wiped away leaves a smooth, shiny finish.
  • Calming feeling. The rhythmic sound of scrubbing soothes the mind.
  • Cleaning motivation. Watching a floor get washed makes people want to tidy up.
mervecleaningasmrsatisfying scrubbingfoam cleaningfloor scrubberhome organizationcleaning motivationoddlysatisfyingsoap bubblessqueegeefloor washclean homefloor care

Bütün evi köpükle yıkama fikri çık aklımdan 😂🥲

watch on instagram
45

@temizlikrehberim Merve 🌸🫧 · 16 May 2026

32.5x outlier

A fast montage shows rich white soap foam being poured, squeezed, wiped, and scrubbed around a clean home.

455K views
16K likes
46 comments
1.8K shares
656 saves
63K followers
13s long
3.5% liked
hookThick white foam pouring onto a rug combined with crisp ASMR sound grabs attention immediately.
  • Visual start. Thick white soap foam pours onto a soft carpet in a steady stream.
  • Light and setting. Soft daylight shines down on clean grey tiles and light fabrics.
  • Audio cues. Rich squishy foam sounds start instantly without any background music.
  • Text on screen. Clear letters ask viewers to turn up their sound for ASMR.
  • Broad appeal. Satisfying cleaning clips appeal to almost anyone scrolling online.
retainRapid cuts between different soapy cleaning tasks keep viewers watching until the last frame.
  • Fast video cuts. Ten shots in 12.9 seconds keep the visuals moving very quickly.
  • Show not tell. Bright foam actions are shown clearly without any talking.
  • Simple tools. Sponges, mops, and buckets create thick lathers that look fun to touch.
  • Easy structure. Each short clip highlights a distinct soapy texture in action.
  • Short duration. The short video length fits the simple satisfying theme perfectly.
rewardViewers feel relaxed and inspired to clean after watching the pleasant foam textures.
  • Deep calm. Crisp squishy foam sounds help quiet a busy mind.
  • Cleaning motivation. Seeing thick soapy bubbles makes housework look enjoyable.
  • Visual delight. Bright white foam on clean tiles creates pleasant visual patterns.
mervetemizlikrehberimcleaning asmrsoap foamsatisfying soundsfoam squeezingrug cleaningtile moppingscrubbingbubbly latherdeep cleanhome organizationsensory videorelaxing clips

🎧🪩🫧

watch on instagram
46

@temizlikrehberim Merve 🌸🫧 · 18 Apr 2026

32.1x outlier

A person scrubs and washes a glass table with soap and water to make satisfying ASMR sounds.

450K views
6.3K likes
54 comments
392 shares
676 saves
63K followers
18s long
1.4% liked
hookBright natural light and sharp scrubbing sounds pull the viewer in instantly.
  • Setting the scene. A bright balcony table filled with clean sunlight sets a calm mood.
  • Visual elements. A woman puts down a white bucket filled with colorful cleaning items.
  • Audio cues. Crisp sounds of scrubbing tools clicking together create instant ASMR interest.
  • Broad subject. Cleaning and satisfying sound videos appeal to almost everyone on social media.
retainFast camera cuts and thick soapy foam keep the video moving forward quickly.
  • Fast pacing. The video uses 16 shots in 18.1 seconds, changing the view every 1.1 seconds.
  • Clear steps. The creator pours soap, scrubs foam into swirl patterns, splashes water, and wipes the glass dry.
  • Key props. The pink brush, squeegee, and glass table are needed to make the sound and foam visuals.
  • Visual payoff. Seeing white soap scraped off to show crystal clear glass keeps people watching until the end.
rewardViewers walk away feeling calm and motivated to clean their own spaces.
  • Deep satisfaction. Watching soapy foam get scraped away from clear glass feels very pleasing.
  • Calm mood. Soft splashing water and scrubbing noises create a cozy relaxing feel.
  • Tidy motivation. Seeing a gleaming table makes viewers want to clean up their own homes.
mervetemizlikrehberimcleaningasmrfoam cleaningsatisfyingscrubbingglass tablebalcony cleaningsqueegeecleaning soundsoutdoor tabledeep cleanfoamhome organization

🫧🛁🩰 . . . . #temizlik #foam #foamcleaning #asmrcleaning #clean

watch on instagram
47

@temizlikrehberim Merve 🌸🫧 · 8 Jul 2026

31.0x outlier

A woman cleans a glass balcony door using soapy sponges, small brushes, and a squeegee.

434K views
2.8K likes
18 comments
143 shares
177 saves
63K followers
15s long
0.6% liked
hookThe close-up squeeze of soapy pink foam grabs attention with satisfying squishy sound.
  • Bright pink glove. A hand wearing a pink rubber glove squeezes a sponge soaked in thick white foam.
  • Close-up camera. The shot sits very close to show bubbles dripping directly into a bucket.
  • Crisp audio. Soft squishy foam sounds fill the video with rich sound detail.
  • No text. There are no words on screen, keeping the focus entirely on the action.
  • Broad topic. Cleaning white doors and glass appeals to anyone who likes neat spaces.
retainFast cuts and crisp scrubbing sounds keep viewers watching every step of the cleaning process.
  • Visual action. The video shows full cleaning steps from scrubbing to squeegeeing without talking.
  • Fast cut pacing. There are 9 shots in 15.2 seconds, changing every 1.7 seconds to stay snappy.
  • Dirty to clean. Watching soapy water get scraped off clear glass feels deeply rewarding.
  • Key props. Sponges, scrubbing brushes, and squeegees drive every single moment.
  • Easy order. The cleaning goes smoothly from the door frame to glass panes and lock details.
  • Right length. At 15.2 seconds, the quick video delivers full satisfaction without taking too long.
rewardViewers feel calm, satisfied, and inspired to clean their own home windows.
  • Deeply satisfying. Seeing dirty glass become spotlessly clear feels very relaxing.
  • Audio comfort. The squishing and scraping sound effects give pleasant audio feelings.
  • Clean motivation. It makes people want to grab a soapy sponge and wash dirty surfaces.
  • Simple habits. Watching basic tools make a door shine reminds viewers of easy tidy routines.
mervecleaning asmrsdeep cleanbalcony door cleaningglass squeegeesatisfying scrubbinghome organizationcleaning motivationsoapy foamwindow washhouse cleaningpink gloves
48

@temizlikrehberim Merve 🌸🫧 · 15 May 2026

30.2x outlier

A woman scrubs dirty door frames and window glass to make them shine, using bright pink gloves and bubbly soap.

423K views
2.6K likes
36 comments
157 shares
233 saves
63K followers
25s long
0.6% liked
hookThe crisp scrubbing sound and deep cleaning action stop viewers in their tracks.
  • Bright gloves. A hand wearing a pink rubber glove holds a grey brush to scrape away dirt.
  • Bright light. Natural light shines clearly on the white door frame and floor.
  • Crisp sounds. Crunchy scraping and bubbly soap noises play without any background music.
  • No text. The video starts directly with action without any title text on screen.
  • Everyday chore. Window and door frame cleaning is a task everyone recognizes.
retainFast cuts and satisfying audio effects keep the viewer watching until everything looks spotless.
  • Useful cleaning. Watching dirty edges become sparkling clean gives immediate satisfaction.
  • Shown visually. Every step is shown directly without any talking or extra explanations.
  • Satisfying feel. The rhythmic scrubbing and wiping create a sense of calm and order.
  • Fast edit rate. There are 15 shots in 24.5 seconds, changing shots every 1.6 seconds to keep up the pace.
  • Simple tools. Sponges, brushes, a squeegee, and a bucket of water are essential to every shot.
  • Clear sequence. The steps move smoothly from scrubbing dirty tracks to wiping and drying.
  • Perfect timing. The 24.5 second runtime fits the quick cleaning routine perfectly.
rewardViewers gain a restful moment and feel inspired to clean their own home.
  • Deeply satisfying. Seeing dark grime disappear instantly relaxes the viewer.
  • Sensory pleasure. Squishing soapy sponges and wiping glass sound crisp and pleasant.
  • Cleaning inspiration. The quick results make you want to tidy up your own doors and windows.
mervecleaningasmrsatisfyingdeep cleandoor cleaningwindow squeegeecleaning hackshome organizationsoap bubblesscrubbingcleaning soundstidy homesatisfying cleaning video

Sesi aç 🎧⭐️✨

watch on instagram
49

@temizlikrehberim Merve 🌸🫧 · 10 May 2026

29.9x outlier

A rug gets cleaned with a lot of soapy foam, scrubbing, and water rinsing in a quick video.

419K views
8.1K likes
86 comments
585 shares
708 saves
63K followers
9s long
1.9% liked
hookSoap pouring over a rug with loud sounds instantly pulls viewers in.
  • Visual action. A thick wave of white soap pours onto a round rug on a tiled floor.
  • Bright setting. Daylight shines across the rug while foam spreads around.
  • Loud sound. Crisp washing sounds play without any music in the background.
  • Text overlay. Simple white text in the middle tells viewers to turn on the sound.
  • Broad appeal. Anyone who likes satisfying cleaning videos will want to watch.
retainFast edits and crisp sounds keep people watching each step of the rug wash.
  • Action over words. The video shows the cleaning instead of talking about it.
  • Fast editing. The video switches between 9 shots in 9.1 seconds to keep the speed high.
  • Key tools. Soap, a scrub brush, and a water hose make the whole video work.
  • Clear steps. Pouring soap, scrubbing hard, and rinsing off the dirt follow a simple path.
  • Right length. Nine seconds is just long enough to show the full clean without getting boring.
rewardViewers feel calm and relaxed after watching the rug become clean.
  • Deeply satisfying. Seeing dirt wash away in white foam feels good.
  • Calming sound. Crisp scrubbing sounds give a nice feeling to the ears.
  • Inspiration to clean. Watching a fresh rug makes people want to wash their own things.
mervecarpet cleaningrug washasmr cleaningfoam scrubbingsoap sudssatisfying videorug cleaning asmrdeep cleanfoam cleaningoddlysatisfyingrug washingcleaning soundshose rinse

Benden size bol köpüklü foşurtulu halı yıkama videosu sesi aç ve izle arkana yaslanmayı unutma 🎧💜 . . . #carpetcleaning #halıyıkama #asmrcleaning #foam #reklam

watch on instagram
50

@temizlikrehberim Merve 🌸🫧 · 5 Aug 2026

27.4x outlier

A person cleans decorative wall panels using a green cloth attached to a flat mop.

383K views
1.9K likes
38 comments
112 shares
190 saves
63K followers
12s long
0.5% liked
hookCrisp pouring sounds and bright pink gloves grab attention immediately.
  • Visual setup. Pink rubber gloves pour golden soap into a bucket of water on a light floor.
  • Sound cues. Clear pouring and splashing sounds play without any background music.
  • Broad appeal. Cleaning walls and home spaces is something almost everyone understands.
retainQuick cuts and satisfying wiping movements keep the viewer watching until the end.
  • Clear story. The video shows mixing soap, wringing the cloth, clipping it to a mop, and wiping the wall.
  • Fast editing. There are 12 shots in 12.4 seconds, with a cut roughly every second.
  • Satisfying action. Watching the green cloth glide across the white wall panels feels relaxing.
  • Simple tools. Using a flat mop handle to hold a rag shows a smart way to reach high spots.
rewardViewers feel refreshed by the neat result and get a helpful cleaning idea.
  • Sound enjoyment. Hearing wet cloth squish and slide across the wall creates a pleasant feeling.
  • Cleaning motivation. Seeing a dirty or dusty wall turn shiny makes people want to clean.
  • Useful trick. The video teaches a simple way to wash walls without climbing a ladder.
mervetemizlikrehberimcleaning asmrwall cleaninghouse cleaning tipsmop hacksatisfying cleaningcleaning hackshome carecleaning routinewall washingdeep cleancleaning sound

Duvar silme günü 💞🌸✨ . . . #temizlikvideoları #reklam #cleaningasmr #evtemizliği #temizlikönerileri

watch on instagram
51

@temizlikrehberim Merve 🌸🫧 · 26 Apr 2026

25.3x outlier

A woman cleans a very dirty glass stove top until it shines like new.

354K views
2K likes
31 comments
107 shares
122 saves
63K followers
21s long
0.6% liked
hookSeeing a horribly messy stove get cleaned immediately grabs attention.
  • Dirty stove top. A very messy black glass stove with burnt food grease and grime.
  • Bright kitchen setting. The light is clear and bright against white tiled walls.
  • Real cleaning sounds. Original ASMR audio starts right away with clinking stove parts.
  • Broad household theme. Cleaning a dirty stove is something almost everyone relates to.
retainThe step by step cleaning process and fast cuts keep viewers watching to see the end result.
  • Satisfying transformation. Watching thick grease scrubbed off a shiny surface is deeply satisfying.
  • Shown not told. The video shows every step clearly without any talking or text on screen.
  • Fast shot changes. The video has 11 shots in 20.6 seconds, changing about every 1.9 seconds.
  • Key cleaning props. Pink cleaning paste, a scraper blade, paper towels, and a pink cloth drive the action.
  • Simple sequence. The steps flow logically from applying paste to scraping dirt and wiping dry.
  • Perfect length. At just 20.6 seconds, the fast pacing matches the quick cleanup concept.
rewardViewers enjoy a satisfying visual cleanup and soothing scrubbing sounds.
  • Deeply satisfying. Seeing dark grime disappear gives a pleasant feeling of order.
  • Soothing sounds. The natural scrubbing and wiping noises feel calming to listen to.
  • Motivation to clean. It makes viewers want to go clean their own kitchens right away.
mervetemizlikrehberimstove cleaningcleaning asmrdeep cleankitchen cleaningglass cooktopsatisfying cleaningscrubbing stovekitchen hacksclean homeviral cleaning

🧽🫧 . . . #ocaktemizliği #evtemizliği #temizlikasmr

watch on instagram
52

@temizlikrehberim Merve 🌸🫧 · 15 Jul 2026

24.5x outlier

A person squeezes pink cleaning soap on a dirty balcony ledge, scrubs it with a brush, and rinses it clean with water.

344K views
3K likes
18 comments
161 shares
177 saves
63K followers
13s long
0.9% liked
hookA person stops scrolling because they see thick pink soap poured onto a dirty surface, which promises a quick and satisfying cleanup.
  • Bright pink soap. The video opens with bright pink cleaning soap squeezed out of a bottle onto a concrete balcony rail.
  • Outdoor balcony setting. The background shows an outdoor balcony with green leaves and a metal rail in daylight.
  • Crisp scrubbing sounds. The natural audio plays crisp, satisfying pouring and scrubbing sounds.
  • No text on screen. There are no words on the screen, letting the clean visuals speak for themselves.
  • Broad cleaning appeal. Anyone who enjoys satisfying cleaning clips or ASMR sounds will feel pulled in right away.
retainThe viewer watches to the end to see the dirty rail turn completely clean after scrubbing and rinsing.
  • Satisfying transformation idea. Watching dirty marble get covered in white foam and then rinsed clean feels deeply satisfying.
  • Shown not explained. The process is shown directly with real audio, without any talking or extra commentary.
  • Calm and steady action. The person works steadily with simple hand movements, keeping the mood calm and relaxed.
  • Single continuous shot. The video is one unbroken take lasting 12.7 seconds, keeping the motion smooth and real.
  • Essential cleaning tools. The pink soap, scrubbing brush, and water stream are the main focus and make the video work.
  • Easy step by step. Squeeze soap, scrub thoroughly, and rinse with water, making it simple to follow.
  • Perfect short length. At under 13 seconds, the video ends right as the surface becomes clean, keeping viewers hooked.
rewardThe viewer feels satisfied and refreshed after watching a quick dirt-to-clean transformation with crisp audio.
  • Deeply satisfying visual. Seeing the grey dirt wash away with clear water leaves a feeling of neatness and order.
  • Soothing ASMR sounds. The natural scrub and splash sounds create a calm, relaxing listening experience.
  • Simple cleaning motivation. The short clip reminds people how quick and easy cleaning a small outdoor spot can be.
mervetemizlikrehberimasmr cleaningcleantoksatisfying cleaningbalcony cleaningscrubbing soaprinsing watersatisfying audiooutdoor cleaningcleaning soapscrubbing brushclean home

Foşur foşurrr 🫧🩷🧹 . . . #asmrcleaning #cleantok #cleanwithme #satisfyingcleaning #temizlik

watch on instagram
53

@temizlikrehberim Merve 🌸🫧 · 17 Aug 2026

23.9x outlier

A person squeezes soap onto a glass table and scrubs it into thick foam before washing it clean.

335K views
2.7K likes
27 comments
151 shares
167 saves
63K followers
10s long
0.8% liked
hookA person stops scrolling because watching bright pink soap squeeze onto glass with loud squishing sounds instantly grabs attention.
  • Fast visual. Bright pink soap squirts onto a glass table in thick swirls right away.
  • Patio setting. Sunlight shines on a clean table near an outdoor sliding door.
  • Crisp sound. Loud squishing sound effects play clearly without any background music.
  • Broad topic. Cleaning videos appeal to anyone who enjoys neat spaces and satisfying routines.
retainViewers watch until the end to see the white foam rinse away and leave a sparkling clear table.
  • Foamy satisfaction. Scrubbing the soap creates thick white swirls that cover the whole table.
  • No talking. The video shows the cleaning process through sound and motion without any voices.
  • Quick edits. With 10 shots in 10.4 seconds, a new shot appears about every second to keep interest high.
  • Key tools. The soap, scrub brush, and water bucket are needed for the cleaning sequence.
  • Simple steps. The action flows logically from soaping to scrubbing to rinsing and wiping.
rewardViewers walk away feeling calm from the gentle ASMR sounds and inspired to tidy up.
  • Oddly satisfying. Watching foam rinse off dirty glass gives a quick feeling of deep satisfaction.
  • ASMR joy. Scrubbing noises and water splashes sound very pleasant to hear.
  • Tidy motivation. Seeing a sparkling fresh surface makes people want to clean their own spaces.
mervetemizlikrehberimcleaning asmrscrubbing foamglass table cleaningsatisfying soap videodeep clean outdoor tablesoapy foam scrubbingcleaning routineodd satisfactionwater rinse

Köpütmeden içine sinmeyenler 🙋🏻‍♀️🌸✨ . . . #temizlikvideoları #temizlik #temizlikönerileri #evtemizliği #keşfet

watch on instagram
54

@temizlikrehberim Merve 🌸🫧 · 25 Jul 2026

22.7x outlier

A person uses a brush and soap to scrub thick dirt off a marble balcony ledge and rinses it clean.

318K views
2.6K likes
15 comments
124 shares
126 saves
63K followers
14s long
0.8% liked
hookThe visual of dirty brown grime being scrubbed off white marble instantly catches the eye.
  • Dirty outdoor ledge. A hand pours yellow cleaning soap onto a very dirty marble surface outside.
  • Natural sounds. Crisp scrubbing sounds create immediate interest without any background music.
  • No text on screen. The screen has no written words, keeping all attention on the action.
  • Broad appeal. Seeing dirty surfaces get turned completely clean appeals to almost everyone.
retainViewers stay to see if the dirty marble ledge will actually become clean at the end.
  • Satisfying result. The deep grime turns into foam and vanishes under the small brush.
  • Shown not told. The video relies purely on the visual process without any talking or explanation.
  • Paced video cuts. There are 6 shots in 13.5 seconds, changing every 2.2 seconds to keep the pace brisk.
  • Essential tools. The small brush and liquid soap are necessary to complete the task.
  • Simple story flow. The steps go smoothly from pouring soap to scrubbing and rinsing with water.
  • Right length. The short 13.5 second video fits this quick cleaning task well.
rewardViewers feel satisfied watching a filthy surface become bright and clean.
  • Deep satisfaction. Watching thick brown dirt get rinsed away feels deeply rewarding.
  • Cleaning motivation. The quick transformation makes viewers want to clean their own balconies.
  • Calming sounds. The rhythmic scrubbing and water rinsing sounds help relax the viewer.
mervetemizlikrehberimcleaning asmrsmarble cleaningbalcony scrubbingsatisfying cleaningdirt removaldeep cleancleaning hacksurface cleaningsatisfying videosscrubbing sound

PART 9 ⭐️

watch on instagram
55

@temizlikrehberim Merve 🌸🫧 · 12 Jun 2026

22.6x outlier

A woman uses soapy water and a squeegee to clean a dirty glass window until it shines.

316K views
1.7K likes
33 comments
143 shares
196 saves
63K followers
12s long
0.5% liked
hookThe crunchy audio of soapy bubbles dipping into a bucket grabs immediate attention.
  • Soapy bubbles. Thick white foam fills a bucket as a pink brush stirs it around.
  • Bright lighting. Natural daylight fills the room and makes the white bubbles pop.
  • Crisp audio. Real cleaning sound effects create a pleasing visual and audio pull.
  • Broad topic. Cleaning house windows is a simple chore that almost anyone relates to.
retainThe quick edit sequence shows every satisfying step from soapy foam to clear glass.
  • Rapid cuts. There are 13 shots in 11.6 seconds, so a new shot appears about every 0.9 seconds.
  • Show not tell. The video demonstrates the whole cleaning process without any speaking.
  • Essential tools. A scrubbing brush, squeegee, and rag make every step clear to follow.
  • Satisfying progress. Watching squeegee strokes wipe away soap foam keeps viewers watching to the end.
rewardViewers get a calm feeling and helpful motivation to wash their own windows.
  • Visual satisfaction. Seeing foam disappear in clean straight lines feels very neat.
  • Simple cleaning method. The video teaches a simple routine for washing dirty window panes.
  • Motivation boost. Viewers feel inspired to grab a bucket and scrub their own house windows.
mervetemizlikrehberimcleaningwindow cleaningsqueegeeasmrsatisfyingsoap foamcleaning motivationhouse choresdeep cleanglass cleaningwindow washingsatisfying video

En sevdiğim en sevdiğim 🩷🫧

watch on instagram
56

@temizlikrehberim Merve 🌸🫧 · 7 Jul 2026

22.3x outlier

A person covers a glass door in thick soap foam and rinses it clean with a hose.

312K views
3.4K likes
28 comments
129 shares
112 saves
63K followers
14s long
1.1% liked
hookThe sudden view of thick white foam spreading across glass grabs your attention right away.
  • Visual start. A red mop swipes bright white soap foam across dark glass.
  • Bright light. Outdoor sunlight shines through the bubbly suds on the window.
  • Natural sound. Scrubbing sounds and water sprays create a pleasing audio flow.
  • Broad appeal. Satisfying cleaning clips attract anyone who enjoys neat and shiny spaces.
retainThe desire to see the bubbly mess washed away keeps you watching until the end.
  • Visual payoff. You watch thick soap foam turn into clean clear glass.
  • Shown not told. The video shows the full cleaning job without any speaking.
  • Fast pacing. There are 9 shots in 13.7 seconds, with cuts about every 1.5 seconds.
  • Essential tools. The mop and water spray make the cleaning process fun to watch.
  • Easy steps. First the soap rubs onto the glass, then water sprays it clean.
  • Perfect length. The short 13.7 second duration gives a fast burst of satisfaction.
rewardYou feel relaxed and inspired after watching a messy glass door become spotless.
  • Deep satisfaction. Seeing soap foam rinse away to reveal clear glass feels good.
  • Motivated to clean. Watching simple tools work well makes you want to wash windows.
  • Calmed mind. The steady stream of water washing away bubbles relaxes your eyes.
mervetemizlikrehberimwindow cleaningoddlysatisfyingsatisfying cleaningsoap foamasmr cleaningpressure washingglass cleaninghose rinsedeep cleanhouse cleaningglass door

Kalkın cam yıkıyoruz … Acil 🤓

watch on instagram
57

@temizlikrehberim Merve 🌸🫧 · 16 Apr 2026

22.2x outlier

A person pours pink and blue dish soap into a clear cleaning brush handle to make a galaxy effect.

311K views
5.6K likes
26 comments
198 shares
395 saves
63K followers
9s long
1.8% liked
hookSomeone fills a dish wand with colorful soaps that mix like a galaxy.
  • Bold movement. A hand pours bright pink soap into a clear dish wand handle filled with blue soap.
  • Clean setting. The video takes place on a neat counter with bright, natural lighting.
  • Clicky sound. ASMR soap pouring and cap snapping sounds play instead of music.
  • Wide appeal. Cleaning hacks and satisfying visual trends appeal to almost everyone.
retainThe fast cuts and bright swirl of colors keep viewers watching until the soap bubbles up.
  • Visual trick. Mixing purple and blue liquid soap creates a pretty galaxy swirl inside a clear tool.
  • Show not tell. The video relies on crisp visuals and ASMR sounds without any speaking.
  • Fast pacing. The video uses 6 shots in 8.5 seconds, changing shots about every 1.4 seconds.
  • Essential tool. The clear soap-dispensing sponge wand makes the colorful swirl visible.
  • Simple steps. Filling the handle and pressing the button shows a clear process from start to finish.
  • Right length. At under nine seconds, the video ends before the effect wears off.
rewardViewers get a quick moment of visual calm and a fun idea for cleaning.
  • Visually pleasing. Watching bright soap swirl together looks smooth and satisfying.
  • Clever idea. Viewers learn a fun way to make everyday dish washing look pretty.
  • Soothing sound. The squishy ASMR sounds help the viewer relax.
mervecleaning hackssoap galaxydish wandasmr soundssatisfying videoslook cleaningdish soap mixkitchen hackshousehold tipscolorful soapsoap mixingclean lookhome cleaning

Galaxy from soap 🌌🔮🪐 . . . #keşfet

watch on instagram
58

@temizlikrehberim Merve 🌸🫧 · 15 Apr 2026

21.5x outlier

A fast montage shows satisfying ASMR cleaning tasks around the home.

301K views
1.9K likes
27 comments
100 shares
122 saves
63K followers
12s long
0.6% liked
hookThick soapy bubbles and wet scrubbing sounds grab attention instantly.
  • Close view. A hand mixes up rich white foam with a pink brush.
  • Bright light. The video is shot up close in clear lighting.
  • ASMR audio. Soapy squishes and wet scrubbing sounds play with no music or talking.
  • No text. The screen stays completely clear of text.
  • Broad reach. Satisfying soap bubbles and cleaning appeal to almost anyone.
retainRapid cuts of satisfying soap foam and cleaning tools keep viewers watching.
  • Cleaning visual. Seeing soapy foam wiped away gives immediate satisfaction.
  • Show not tell. The video shows crisp cleaning actions without explaining anything.
  • Fast cuts. There are 18 shots in 11.6 seconds to keep the pace moving fast.
  • Cleaning tools. Brushes, sponges, mops, vacuums, and steam cleaners keep scenes interesting.
  • Simple flow. Each brief shot shifts smoothly into another satisfying chore.
  • Right length. The short 11.6 second runtime fits the fast visual idea well.
rewardViewers feel relaxed, satisfied, and inspired to clean their own space.
  • Visual satisfaction. Watching foam wiped away brings a calm sense of order.
  • Soothing sounds. Wet soap squishes give a relaxing sensory break.
  • Tidy spark. The fresh clips make viewers want to grab a brush and clean.
mervetemizlikrehberimcleaningasmrsatisfying soapscrubbing foamwindow squeegeesteam cleanermop spindeep cleanhouse choressatisfying visualsrelaxing soundsclean with me

🧼🫧🪟✨ . . . #Temizliktüyoları #asmrcleaning #cleanwithme #temizlik #temizlikönerileri

watch on instagram
59

@temizlikrehberim Merve 🌸🫧 · 11 Jul 2026

21.2x outlier

A woman cleans her bathroom floor with a spin mop and adds scented laundry softener to make the room smell fresh.

297K views
1.9K likes
20 comments
130 shares
103 saves
63K followers
17s long
0.7% liked
hookBright white soap foam bubbles on the bathroom floor instantly catch your eye as a mop spins through it.
  • Foamy opening. A red mop pushes thick white foam across smooth gray floor tiles.
  • Setting and light. Bright lighting makes the wet floor suds shine clearly.
  • Audio sounds. Soft squishing and water splashing sounds pull you into the action.
  • Broad topic. Cleaning floors and making rooms smell nice is a daily task everyone knows.
retainVery fast cuts and satisfying soap suds keep viewers watching every step of the cleaning routine.
  • Shown not told. The video shows the cleaning steps directly instead of talking.
  • Fast cuts. There are 21 shots in 16.8 seconds, bringing a new shot about every 0.8 seconds.
  • Important prop. The bottle of fabric softener shows the key product needed for a long scent.
  • Easy story. The process goes step by step from soapy scrubbing to adding softener and rinsing.
  • Good length. The short 16.8 second time fits a quick cleaning video without slowing down.
rewardViewers feel relaxed by the clean floor and get a useful idea for making their home smell nice.
  • Satisfying feel. Watching thick foam wash across the tiles feels calming to watch.
  • New trick. Viewers learn to add laundry softener to mop water for extra freshness.
  • Motivation boost. Seeing a shiny bathroom makes people want to clean their own floors.
mervetemizlikrehberimcleaningmopbathroom cleaningsatisfying cleaningfloor moppingspin moplaundry softener trickcleaning routinefresh smellhome carecleaning tips

Temizlik tamam da, o mis gibi koku olmadan bana eksik geliyor. 🤍 Son suya biraz Sır yumuşatıcı ekledim, banyoda bıraktığı kokuya bayıldım. 🌸✨ . . #sırAromatique #3xparfümetkisi #çamaşırparfümü #isbirligi

watch on instagram
60

@temizlikrehberim Merve 🌸🫧 · 31 Jul 2026

21.0x outlier

A fast video shows satisfying home cleaning tasks with crisp scrubbing sounds and foamy soap.

295K views
1.9K likes
28 comments
216 shares
110 saves
63K followers
13s long
0.6% liked
hookThe loud crisp sound of soapy scrubbing immediately catches the ear and eyes.
  • Visual impact. A brush scrubs rich white foam across a wooden floor up close.
  • Real audio. Crisp crunchy scrubbing and squeegee sounds play without any music.
  • Broad appeal. Soothing cleaning videos attract anyone who enjoys neat spaces and satisfying ASMR.
retainQuick cuts and constant visual cleaning action keep the viewer watching.
  • Fast pacing. There are 15 shots in 12.7 seconds, changing the view every split second.
  • Visual satisfaction. Suds, squeegees, and steam wash away dirt on floors, windows, and rugs.
  • Action over words. The video shows full cleaning tasks with real sounds instead of talking.
  • Varied tools. Brushes, mops, wipers, and steam cleaners keep each moment fresh and fun.
rewardViewers feel relaxed by the satisfying cleaning actions and crisp audio.
  • Soothing feeling. Watching dirty spots turn clean brings a calm and happy feeling.
  • ASMR relaxation. Crisp scrubbing and steam sounds give a pleasing sensory experience.
  • Cleaning urge. The neat surfaces make viewers want to tidy up their own home.
merve temizlikrehberimcleaning asmrsatisfying cleaningdeep cleanfloor scrubbingwindow squeegeesteam moptile cleaningrug cleaningsatisfying soundshome motivationtidy look

😮‍💨🫧✨💕

watch on instagram